DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and B4galt1

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_445739.1 Gene:B4galt1 / 24390 RGDID:620900 Length:399 Species:Rattus norvegicus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:137/275 - (49%) Gaps:27/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CPLSNPLAKLAGGGEGVSVIK-KEPAD-----EKQPQ--------PHDHGASVHKMALLVPFRDR 86
            ||..:||.      .|..||. ..|.|     :|.|:        |.| ..|.||:|:::|||:|
  Rat   131 CPEESPLL------VGPMVIDFNIPVDLELLAKKNPEIKMGGRYFPKD-CISPHKVAIIIPFRNR 188

  Fly    87 FEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDY--IAMHDVDLL 149
            .|.|..::.::...|:||.:.:.|:|:||.....||||.|:|||||.|...|||  ....||||:
  Rat   189 QEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTMFNRAKLLNVGFQEALKDYDYNCFVFSDVDLI 253

  Fly   150 PLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEF 214
            |::|:..|...|....:.:|..|......|..:.||:..:.::.|..:||..|.|||||.|||:.
  Rat   254 PMDDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDI 318

  Fly   215 FVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKIL 279
            |.|:...|:.::|| |...|......  |:|..:.....:.|::...|::.....||:::.|::|
  Rat   319 FNRLVHKGMSISRP-NAVVGRCRMIR--HSRDKKNEPNPQRFDRIAHTKETMRLDGLNSLTYQVL 380

  Fly   280 KVHEM-LIDQVPVTI 293
            .:... |..::.|.|
  Rat   381 DIQRYPLYTKITVDI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 73/222 (33%)
B4galt1NP_445739.1 b4GalT 176..394 CDD:132999 71/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.