DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt2

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002931518.2 Gene:b4galt2 / 100492356 XenbaseID:XB-GENE-997913 Length:374 Species:Xenopus tropicalis


Alignment Length:290 Identity:95/290 - (32%)
Similarity:150/290 - (51%) Gaps:38/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VCPLSNPLAKLAGG--GEGVSVIKKEPADEKQPQPHDHGASV-------HKMALLVPFRDRFEEL 90
            :||.:.|  :|.|.  .|..|::..|....:.|...:.|...       .|:|:::|||.|...|
 Frog    99 LCPDAPP--ELVGRLLIEFSSLMSMERVQRENPDVTEGGRYTPPDCQPKEKVAIIIPFRHREHHL 161

  Fly    91 LQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFA---SDVYDYIAMHDVDLLPLN 152
            ..::.::...|:||.||:.|:::||.....||||.|:||||..|   :| ||.....||||:|::
 Frog   162 KYWLHYLHPILRRQKVAYGIYIINQFGEDTFNRAKLLNVGFLEAMKEAD-YDCFIFSDVDLIPMD 225

  Fly   153 DNLLYE-YPSSLGPLH--IAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEF 214
            |..||. |..   |.|  ||..|...:..|..:.||:..:.:..|.::||..|:|||||.|||:.
 Frog   226 DRNLYHCYEQ---PRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLKINGFPNEYWGWGGEDDDI 287

  Fly   215 FVRIRDAGLQVTRPQNIKTGTNDTFSH---IHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKY 276
            :.||...|::::|| :|:.|......|   .||..:.:|.| |..|.| ||.|:|   |::::.|
 Frog   288 YNRITLNGMKISRP-DIRIGRYRMIKHERDKHNEPNPQRFT-KIQNTK-MTMKKD---GINSLHY 346

  Fly   277 KILKVHEMLIDQVPVTILNILLDCDVNKTP 306
            ::  :|..   :.|: ..||.:  |:.|.|
 Frog   347 RV--IHSA---KYPM-YTNITV--DIGKPP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 82/232 (35%)
b4galt2XP_002931518.2 b4GalT 145..363 CDD:132999 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.