DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt3

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_031747171.1 Gene:b4galt3 / 100486704 XenbaseID:XB-GENE-22252019 Length:467 Species:Xenopus tropicalis


Alignment Length:272 Identity:82/272 - (30%)
Similarity:135/272 - (49%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NPLAKLAGGGEGVSVIKKEPADEKQPQPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQ 104
            |||  :..|||     .|.|..|.:          |:.|:::|.|:|...|...:.::..||:||
 Frog   106 NPL--VTRGGE-----YKPPNCEAR----------HRTAIIIPHRNRETHLRHLLYYLHPFLQRQ 153

  Fly   105 GVAHHIFVLNQVDRFRFNRASLINVGFQFA--SDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLH 167
            .:.:.|:::||.....||||.|:|||.:.|  .:.:|.:.:|||||:|.||..|| ......|.|
 Frog   154 QLHYRIYIINQAGNATFNRAKLLNVGVKEALRDEEWDCLFLHDVDLIPENDYNLY-VCDPWNPKH 217

  Fly   168 --IAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQN 230
              :|..|......|..:.||:..:..:.:.:|||..|:|||||.|||:...|:|.||:::||| :
 Frog   218 ASVAMNKFSYSLPYPQYFGGVSALTPDQYMKMNGFPNEYWGWGGEDDDIATRVRLAGMKITRP-S 281

  Fly   231 IKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKIL-KVHEMLIDQVPVTIL 294
            :..|......|..::.:.:...:  |:....|::.....|::::.|.:| :..|.|...|.|   
 Frog   282 VSVGHYKMVKHKVDQGNEENPHR--FDLLIRTQRMWKADGMNSLTYTLLERALEPLYTNVTV--- 341

  Fly   295 NILLDCDVNKTP 306
                  ||.:.|
 Frog   342 ------DVGEDP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 70/228 (31%)
b4galt3XP_031747171.1 b4GalT 123..342 CDD:132999 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.