DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalT7 and b4galt2

DIOPT Version :9

Sequence 1:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001121857.1 Gene:b4galt2 / 100148828 ZFINID:ZDB-GENE-070912-258 Length:379 Species:Danio rerio


Alignment Length:247 Identity:76/247 - (30%)
Similarity:132/247 - (53%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NPLAKLAGGGEGVSVIKKEPADEKQPQPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQ 104
            ||  .:..||      |..|.|.:..|         |:|:::|||.|...|..::.::...|:||
Zfish   133 NP--NVTEGG------KYTPPDCRPKQ---------KVAIIIPFRHRDNHLKYWLHYLHPVLRRQ 180

  Fly   105 GVAHHIFVLNQVDRFRFNRASLINVGFQFA-SDV-YDYIAMHDVDLLPLNDNLLYE-YPSSLGPL 166
            .:.:.|:::||:....||||.|:|||:..| .|. |:.....||||:|::|..||. |..   |.
Zfish   181 KIDYGIYIINQLGEDTFNRAKLLNVGYTEAIKDAEYNCFIFSDVDLIPMDDRNLYHCYDQ---PR 242

  Fly   167 H--IAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQ 229
            |  ||..|...:..|..:.||:..:.::.|.::||..|:|||||.|||:.:.||...|::|:|| 
Zfish   243 HFAIAMDKFGFRLPYAGYFGGVSGLSKKQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKVSRP- 306

  Fly   230 NIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKV 281
            :::.|......|..:: |.:.:.|: |::.:.|:....|.|:.::.|:::.:
Zfish   307 DVRIGRYRMIKHERDK-HNEPNPQR-FSKIQNTKNTMRKDGISSLMYRVVSI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 68/212 (32%)
b4galt2NP_001121857.1 b4GalT 150..368 CDD:132999 69/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.