DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tnc and IBSP

DIOPT Version :9

Sequence 1:NP_001247300.1 Gene:tnc / 42990 FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:289 Identity:72/289 - (24%)
Similarity:111/289 - (38%) Gaps:91/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  2426 PETAAPELEKEVPEKATEQPELEKETP------EKATEQPELEKE-TPEKATEQPELEKETPE-- 2481
            |...:.:..:|..:.::|:.|.|:||.      |::.|..:.|.| |...||.....|..||.  
Human    59 PVQGSSDSSEENGDDSSEEEEEEEETSNEGENNEESNEDEDSEAENTTLSATTLGYGEDATPGTG 123

  Fly  2482 ----KATEQPELEKEVTDKATEQPESVDEKTTPEPVVKPSLDSTEEDEESVESEEESADKKDKNK 2542
                .|.:.|:...::|:|||::.||.:|:              ||:||..|:||..|: .|:|:
Human   124 YTGLAAIQLPKKAGDITNKATKEKESDEEE--------------EEEEEGNENEESEAE-VDENE 173

  Fly  2543 ETEEDTDKKHEEPEVPAVVSEIPQPSEEAVPTTGHPLFPHLASSTTTPPAVDDRVGEEDEENTTV 2607
            :....|.....|             :|....::|                 .|. |||.||.:..
Human   174 QGINGTSTNSTE-------------AENGNGSSG-----------------GDN-GEEGEEESVT 207

  Fly  2608 KLSSSTTTST-TESPVTSAPSTTTVASQQQQPITP--------PPYGHAP--EYEDEYDEEEVFG 2661
            ..::..||.| .:...||  .|||..:...:|.||        ||:|...  |||.||:      
Human   208 GANAEDTTETGRQGKGTS--KTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYE------ 264

  Fly  2662 PGTCRYAG--------KLYVSAQQIPRDD 2682
                 |.|        ::|.|....||.|
Human   265 -----YTGANEYDNGYEIYESENGEPRGD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tncNP_001247300.1 VWC 235..296 CDD:214564
PHA02664 <433..595 CDD:177447
Ehrlichia_rpt 529..1065 CDD:118064
DUF863 <1684..>1788 CDD:283539
VWC 2762..>2805 CDD:302663
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 72/289 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 60/242 (25%)
cell-attachment tripeptide 286..288 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.