DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tnc and Muc18B

DIOPT Version :9

Sequence 1:NP_001247300.1 Gene:tnc / 42990 FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster
Sequence 2:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:86/246 - (34%) Gaps:91/246 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1484 EVSTKKPAVQGP----PLPTLAPAQPEKKPVDAETSTEADISTEPSAEVEK---EASGETSESDN 1541
            |.:|:|||.:.|    .:.|.||...||...:|..:|| .|:||.....||   ||.|.|     
  Fly    98 ESTTEKPATEAPGTTEKVTTAAPGTTEKVTTEAPGTTE-KITTEAPGTTEKITTEAPGTT----- 156

  Fly  1542 EIDAGASSTPVPVSADEDKTPSTEKTVEADDKFTTVAPLAGDEEESNLPKLPQDIFEEEAPVAVT 1606
                                          :|.||.||  |..|:                  :|
  Fly   157 ------------------------------EKITTEAP--GTTEK------------------IT 171

  Fly  1607 TAAPSKDDGEQKPVEVEEKPIEDG----QKPIEDETSTPTSSENEIEPESDRATTIAPSKEEPSE 1667
            |.||.          ..|||..|.    :||..|...|...||          ||.||...:.|:
  Fly   172 TEAPG----------TTEKPATDAPGTTEKPATDAPGTTEKSE----------TTDAPGTTDKSD 216

  Fly  1668 PSTGAPTKDEP--AEPSTDAPESDESKETPESEVPTTVAPAGEKIPTSSIT 1716
              |.||..|||  ||.|||.|.::.::...|:.:...|.......||.|.|
  Fly   217 --TDAPITDEPSTAETSTDEPNTETTESGEETTIEDNVCATTGLFPTGSCT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tncNP_001247300.1 VWC 235..296 CDD:214564
PHA02664 <433..595 CDD:177447
Ehrlichia_rpt 529..1065 CDD:118064
DUF863 <1684..>1788 CDD:283539 8/33 (24%)
VWC 2762..>2805 CDD:302663
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 34/144 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.