DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tnc and Ibsp

DIOPT Version :9

Sequence 1:NP_001247300.1 Gene:tnc / 42990 FlyBaseID:FBgn0039257 Length:2819 Species:Drosophila melanogaster
Sequence 2:NP_036719.2 Gene:Ibsp / 24477 RGDID:2855 Length:319 Species:Rattus norvegicus


Alignment Length:276 Identity:67/276 - (24%)
Similarity:109/276 - (39%) Gaps:54/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 KPTPAEEGSGEEEKDVKVTAAPEETEDEAKPTSAPVASDEKEQEPKPSEGSGDEELDLKPTTAPT 568
            |..|.:.||...|::....::.||.|:|        .:..:|:..:.|||:.|:|.:.:  .|..
  Rat    56 KRFPVQGGSDSSEENGDGDSSEEEGEEE--------ETSNEEENNEDSEGNEDQEAEAE--NATL 110

  Fly   569 AGATSASEESEEQDEGK----STEAPTSVDDIEPAKPTESSEEASGEGEDVAKETTPAGEASIAG 629
            :|.|::.......|.||    :.:.|....|.|...|  ..:|:..|.|:..:|.....||.:..
  Rat   111 SGVTASYGVETTADAGKLELAALQLPKKAGDAEGKAP--KMKESDEEEEEEEEEENENEEAEVDE 173

  Fly   630 EEEIVKGTTPAGEPSSEGDEEIVKGTTPAEESSSESEDELTKVTTPAGEPSVAGEEEIA------ 688
            .|::|.||       |....|:..|..|:...:.|..:| ..||....|.:.||..|:.      
  Rat   174 NEQVVNGT-------STNSTEVDGGNGPSGGDNGEEAEE-ASVTEAGAEGTTAGARELTSYGTTT 230

  Fly   689 -------KETTPAGEPSIAGEEEIVKVTTPAGESSIA--GE--EEIVKVTTPAGESSSEGEEEII 742
                   ::|||  .|...|     ..:.||.:||..  ||  |:|......|.|:..|...|  
  Rat   231 AVLLNGFQQTTP--PPEAYG-----TTSPPARKSSTVEYGEEYEQIGNEYNTAYETYDENNGE-- 286

  Fly   743 KVTTPAGESSSEGDEE 758
                |.|::....::|
  Rat   287 ----PRGDTYRAYEDE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tncNP_001247300.1 VWC 235..296 CDD:214564
PHA02664 <433..595 CDD:177447 22/94 (23%)
Ehrlichia_rpt 529..1065 CDD:118064 60/251 (24%)
DUF863 <1684..>1788 CDD:283539
VWC 2762..>2805 CDD:302663
IbspNP_036719.2 BSP_II 17..316 CDD:283165 67/276 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..116 17/66 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..224 26/98 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..263 9/32 (28%)
Cell attachment site 288..290 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.