DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and SLC38A5

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_005272751.2 Gene:SLC38A5 / 92745 HGNCID:18070 Length:539 Species:Homo sapiens


Alignment Length:544 Identity:115/544 - (21%)
Similarity:203/544 - (37%) Gaps:169/544 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALPKRR-----------PPVQLTPSHQHD-----QLPF----LRRSRFSALP-----------HF 55
            |:|.|:           ||.|.|.....|     .||.    .|:.|...||           .|
Human    24 AVPTRQGLQARVGIAETPPPQETRMELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQF 88

  Fly    56 RAYEDEPE-NLSLF-----------IAILYVVDLFGIFPFVTLPALLVKLGYFGILLVLSIIILQ 108
            ..:|.:.. .:|:|           :.:.|.:...|:.              |.:.|:|.|.:|.
Human    89 MDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMAHTGVI--------------FFLALLLCIALLS 139

  Fly   109 IYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAELAYGPYMSLLVSVLLDL-SIFAMA------- 165
            .|:..||..|..:|.:          ..|..|.:.|:||...::|:.::.| ::.||:       
Human   140 SYSIHLLLTCAGIAGI----------RAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIK 194

  Fly   166 --VPSVVMAAQNLEGVVLRMS-AGQYNFSYCYWAIIVG-LVICPLMWLGSPKHM------RGLAI 220
              :|.|:       |..|.|. .|.:........|||. |:|.||..:   ||:      .||::
Human   195 SELPLVI-------GTFLYMDPEGDWFLKGNLLIIIVSVLIILPLALM---KHLGYLGYTSGLSL 249

  Fly   221 IAVCVMIVIVALLW--FCLFAA-----------PAIGTPFEGISLELPGFLTVLN---SYS--IL 267
              .|::..:|::::  |.|..|           ..:|.|.:|::......:..::   ||:  |:
Human   250 --TCMLFFLVSVIYKKFQLGCAIGHNETAMESEALVGLPSQGLNSSCEAQMFTVDSQMSYTVPIM 312

  Fly   268 AFQFDIHPVLLTLQIDMKQKSQVSWAALIGIAITCSVAIFGSIIAAY---KFGSMIADNLLQSLP 329
            ||.|..||.:|.:..::.:.|:....|:..::|.....::| :.|.:   .|.|.:...:|....
Human   313 AFAFVCHPEVLPIYTELCRPSKRRMQAVANVSIGAMFCMYG-LTATFGYLTFYSSVKAEMLHMYS 376

  Fly   330 TSVPFYVMLILMALQLCFSVTVASSAMFMQIE----------NYFKLPESLSFKRMLIRSSVLAL 384
            ...|   :::.:.|.:..:||:....:...|.          ..|..|..::...:|:    :.:
Human   377 QKDP---LILCVRLAVLLAVTLTVPVVLFPIRRALQQLLFPGKAFSWPRHVAIALILL----VLV 434

  Fly   385 EVLVAEFVPSFDALMDVVGGTITGPLVFILPPLLYRRIRRMERVHQRIAAEASYGSLPLDLNYDP 449
            .|||. .||:...:..|:|.|....|:||||.:.|.||                           
Human   435 NVLVI-CVPTIRDIFGVIGSTSAPSLIFILPSIFYLRI--------------------------- 471

  Fly   450 VDLEMEPLLVISPPTTPRGC--WL 471
            |..|:||.|  |.|.. :||  |:
Human   472 VPSEVEPFL--SWPKI-QGCQAWI 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 80/364 (22%)
SLC38A5XP_005272751.2 SLC5-6-like_sbd 93..484 CDD:294310 95/464 (20%)
SdaC 93..476 CDD:223884 90/454 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.