DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and AT1G08230

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001077487.1 Gene:AT1G08230 / 837344 AraportID:AT1G08230 Length:451 Species:Arabidopsis thaliana


Alignment Length:303 Identity:64/303 - (21%)
Similarity:114/303 - (37%) Gaps:79/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 RMSAGQYNFSYCYWAIIVGLVI---C-PLMWL-----GSPKHMRGLAIIAVCVMIVI-------- 229
            |...|....:.||..:|...::   | ..|:|     |..| :....||..|:::|:        
plant   112 RYYVGPIQMAVCYGVVIANALLGGQCLKAMYLVVQPNGEMK-LFEFVIIFGCLLLVLAQFPSFHS 175

  Fly   230 ------VALLWFCLFAAPA--------------------IGTPFEGISLELPGFLTVLNSYSILA 268
                  ::||...|::|.|                    :|.|...:       ..:.|:.:|:|
plant   176 LRYINSLSLLLCLLYSASAAAASIYIGKEPNAPEKDYTIVGDPETRV-------FGIFNAMAIIA 233

  Fly   269 FQFD---IHPVLLTLQIDMKQKSQ--VSWAALIGIAITCSVAIFGSIIAAYKFGSMIADNLLQS- 327
            ..:.   |..:..|:...:|.|..  :....|:.|....:|||.|......|...:|..|.|.: 
plant   234 TTYGNGIIPEIQATISAPVKGKMMKGLCMCYLVVIMTFFTVAITGYWAFGKKANGLIFTNFLNAE 298

  Fly   328 -----LPTSVPFYVMLILMALQLCFSVTVASSAMFMQ-----IENYFKLPESLSFK------RML 376
                 :||...|.|.|..: |||.     |.:.:::|     :|:....|....|.      |::
plant   299 TNHYFVPTWFIFLVNLFTV-LQLS-----AVAVVYLQPINDILESVISDPTKKEFSIRNVIPRLV 357

  Fly   377 IRSSVLALEVLVAEFVPSFDALMDVVGGTITGPLVFILPPLLY 419
            :||..:.:..:||..:|.|..:..::|.....||.|:||.:.:
plant   358 VRSLFVVMATIVAAMLPFFGDVNSLLGAFGFIPLDFVLPVVFF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 64/303 (21%)
AT1G08230NP_001077487.1 SLC5-6-like_sbd 29..440 CDD:382020 64/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570025at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48017
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.