DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and LAX1

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_195744.1 Gene:LAX1 / 831866 AraportID:AT5G01240 Length:488 Species:Arabidopsis thaliana


Alignment Length:382 Identity:81/382 - (21%)
Similarity:138/382 - (36%) Gaps:63/382 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VTLPALLVKLGYF-GILLVLSIIILQIYTSFLLSQCWT--MAELLDPSIQQKRNY---------- 135
            :|||....:||.. ||||.:...::..:|::|:|..:.  .|.:.....:..:|:          
plant    70 LTLPYSFSQLGMLSGILLQIFYGLMGSWTAYLISVLYVEYRARMEKQEAKSFKNHVIQWFEVLDG 134

  Fly   136 ---PYAALAELAYGPYMSLLVSVLLDLSIFAMAVPSVVMAAQNLEGVVLRMSAGQYNFSYCYWAI 197
               ||...|.||:.....|..||:           .::..|.|:..:..|:....       |..
plant   135 LLGPYWKAAGLAFNCTFLLFGSVI-----------QLIACASNIYYINDRLDKRT-------WTY 181

  Fly   198 IVGLVICPLMWLGSPKHMR-----GLAIIAVCVMIVIVALLWFCLFAAPAIGTPFEGISLELPGF 257
            |.|......:::.|..:.|     ||.:.....        |:...|:...|.. ||::...|..
plant   182 IFGACCATTVFIPSFHNYRIWSFLGLGMTTYTA--------WYLTIASFLHGQA-EGVTHSGPTK 237

  Fly   258 LTV-LNSYSILAFQFDIHPVLLTLQIDM----KQKSQVSWAALIGIAITCSVAIFGSIIAAY-KF 316
            |.: ....:.:.:.|..|.|.:.:...|    |.||....|.|....:|     ..|..|.| .|
plant   238 LVLYFTGATNILYTFGGHAVTVEIMHAMWKPRKFKSIYLMATLYVFTLT-----LPSASAVYWAF 297

  Fly   317 GSMIAD--NLLQSLPTSVPFYVMLILMALQLCFSVTVASSAMFMQIENYFKLPESLSF-KRMLIR 378
            |..:.:  |....||.:......:|||.:....:...|.:.::...|....:..:.|. .|.|:|
plant   298 GDQLLNHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLYFVWEKAIGMHHTKSLCLRALVR 362

  Fly   379 SSVLALEVLVAEFVPSFDALMDVVGGTITGPLVFILPPLLYRRIRRMERVHQRIAAE 435
            ..|:.....:|...|.|..:...||..:....|:|:|.|.:....|.... :|.|||
plant   363 LPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIPALAHMLTYRTASA-RRNAAE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 68/344 (20%)
LAX1NP_195744.1 PLN03074 1..474 CDD:215559 81/382 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.