DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and AT5G15240

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_197028.1 Gene:AT5G15240 / 831376 AraportID:AT5G15240 Length:423 Species:Arabidopsis thaliana


Alignment Length:373 Identity:92/373 - (24%)
Similarity:164/373 - (43%) Gaps:52/373 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VTLPALLVKLGYFGILLVLSIIILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAELAYGPY 148
            :::|..|...|:..::::.::.|...|.:.|:.:|..|..||       |:||  .:...|:|..
plant    52 LSVPYALASGGWLSLIILFTVAITTFYCAILIKRCMEMDPLL-------RSYP--DIGYKAFGNT 107

  Fly   149 MSLLVSVLLDLSIFAMAVPSVVMAAQNL----EGVVLRMSAGQYNFSYCYWAIIVGLVICPLMWL 209
            ..::||:.::|.::.:|...:::...||    ..|.|.....::.....: .|:|.|:|.|.:||
plant   108 GRVIVSIFMNLELYLVATSFLILEGDNLNKLFSNVGLNFMGLEFQGKQMF-IIMVALIILPSVWL 171

  Fly   210 GSPKHMRGLAIIAVCVMIVIVALLWFCLFAAPAIGTPFEGISLE--------LPGFLTVLNSYSI 266
            .:.:.:..::...|....||:|.::       ::|. |||:..:        |.|   |..|.|:
plant   172 DNMRILSYVSASGVFASGVILASIF-------SVGA-FEGVGFKNNDSEVFRLNG---VATSVSL 225

  Fly   267 LAFQFDIHPVLLTLQIDMKQKSQVSWAALIGIAIT----CSVAIFGSIIAAYKFGSMIADNLLQS 327
            .||.:..|||..||...||.|.|.|...:|...|.    .|||:.|.::    :||.:...:..:
plant   226 YAFCYCAHPVFPTLYTSMKNKRQFSNVMIICFTICTFIYASVAVLGYLM----YGSDVESQITLN 286

  Fly   328 LPT-----SVPFYVMLILMALQLCFSVTVASSAMFMQIENYFKLPESLSFKRMLIRSSVLALEVL 387
            |||     .|..:..|:....:....||....||..:.........:..|   |:.:.::...|:
plant   287 LPTDKLSSKVAIWTTLVNPIAKFALMVTPIIDAMRSRFSRVLPNKRASGF---LLSTILVTSNVI 348

  Fly   388 VAEFVPSFDALMDVVGGTITGPLVFILPPLLYRRIRRMERVHQRIAAE 435
            ||..:|.|..||.:||..::.....|||.|.|.:|   ...:||:..|
plant   349 VALLLPFFGDLMSLVGAFLSASASVILPCLCYLKI---SGKYQRLGFE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 85/336 (25%)
AT5G15240NP_197028.1 SLC5-6-like_sbd 31..416 CDD:382020 92/373 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I2556
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570025at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100570
Panther 1 1.100 - - O PTHR48017
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.