DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and AUX1

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_565882.1 Gene:AUX1 / 818390 AraportID:AT2G38120 Length:485 Species:Arabidopsis thaliana


Alignment Length:375 Identity:78/375 - (20%)
Similarity:137/375 - (36%) Gaps:43/375 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VTLPALLVKLGYFGILLVLSIIILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAELAYGPY 148
            :|||....:||      :||.|:|||:...|.|  || |.|:.....:     |.|..|.....:
plant    65 LTLPYSFSQLG------MLSGIVLQIFYGLLGS--WT-AYLISVLYVE-----YRARKEKEGKSF 115

  Fly   149 MSLLVS--VLLD--LSIFAMAVPSVVMAAQNLEGVVLRMSAGQYNFSYC-------YWAIIVGLV 202
            .:.::.  .:||  |..:..|:.........|.|.|:::.|...|..|.       .|..|.|..
plant   116 KNHVIQWFEVLDGLLGSYWKALGLAFNCTFLLFGSVIQLIACASNIYYINDHLDKRTWTYIFGAC 180

  Fly   203 ICPLMWLGSPKHMR-----GLAIIAVCVMIVIVALLWFCLFAAPAIGTPFEGISLELPGFLTV-L 261
            ....:::.|..:.|     ||.:.....        |: |..|..|....||:....|..|.: .
plant   181 CATTVFIPSFHNYRIWSFLGLGMTTYTA--------WY-LAIASIIHGQAEGVKHSGPTKLVLYF 236

  Fly   262 NSYSILAFQFDIHPVLLTLQIDMKQKSQVSWAALIGIAITCSVAIFGSIIAAYKFGSMIAD--NL 324
            ...:.:.:.|..|.|.:.:...|.:..:..:..|:......::.|..:....:.||..:.|  |.
plant   237 TGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLMATLYVFTLTIPSAAAVYWAFGDALLDHSNA 301

  Fly   325 LQSLPTSVPFYVMLILMALQLCFSVTVASSAMFMQIENYFKLPESLSF-KRMLIRSSVLALEVLV 388
            ...:|.:......:|||.:....:...|.:.::...|....:.::.|. .|.|.|..|:.....:
plant   302 FSLMPKNAWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFL 366

  Fly   389 AEFVPSFDALMDVVGGTITGPLVFILPPLLYRRIRRMERVHQRIAAEASY 438
            |...|.|..:...||..:....|:|:|.|.:....|.....|..|.:..:
plant   367 AIIFPFFGPINSAVGALLVSFTVYIIPSLAHMLTYRSASARQNAAEKPPF 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 65/335 (19%)
AUX1NP_565882.1 PLN03074 2..469 CDD:215559 78/375 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.