DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and slc36a1

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_021336836.1 Gene:slc36a1 / 559308 ZFINID:ZDB-GENE-061117-1 Length:468 Species:Danio rerio


Alignment Length:423 Identity:87/423 - (20%)
Similarity:159/423 - (37%) Gaps:92/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EDEP-----------ENL------SLFIAILYVV------DLFGIFPFVTLPALLVKLGYFGILL 100
            ||||           |.:      |:...|::::      .|.|:...|....|||     |.|.
Zfish    22 EDEPIHSPGSRQTEYERIGGRTGSSVLQTIIHLLKGNIGTGLLGLPLAVRNAGLLV-----GPLS 81

  Fly   101 VLSIIILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAELAYGPYMSL-------------- 151
            :|.:.|:.::...||.:|       ...:..|...|:     |:||..:..              
Zfish    82 LLIMGIVAVHCMNLLVKC-------AHHLSAKLGKPF-----LSYGDAVEYGMENVSWLSRHSIW 134

  Fly   152 ---LVSVLLDLSIFAMAVPSVVMAAQNLEGVVLRMSAGQYNF-------------SYCYWAIIVG 200
               :|::.|:::.........|..:.|::.||...:|...|.             |..|....:.
Zfish   135 GRHVVNLFLNITQLGFCCVYFVFLSDNVKQVVETANATTGNCHNNETAVPVPSYDSRLYMVFFLP 199

  Fly   201 LVICPLMWLGSPKHMRGLAIIA-VCVMIVIVALLWFCLFAAP-AIGTPFEGISLELPGFLTVLNS 263
            .:|. |:::.:.|::..|:..| :|:...:|.:.::||...| .|..|..|...:.|.|      
Zfish   200 FIIL-LVFIRNLKYLAPLSFAANICMCASLVLIYYYCLTNIPNPINLPLAGRGADYPLF------ 257

  Fly   264 YSILAFQFDIHPVLLTLQIDMKQKSQVSWAALIGIAITCSVAIFGSIIAAYKFGSMIADNLLQSL 328
            :....|.|:...|:|.|:..|:.....:....:|:.|...:.|....|....||..|..::..:|
Zfish   258 FGTAIFAFEGIGVVLPLENKMQNPRNFTKVLYLGMGIVTFLYISLGTIGYIGFGEEIRGSITLNL 322

  Fly   329 PTSVPFYVMLIL--------MALQLCFSVTVASSAMFMQIENYFKLPESLSFKRMLIRSSVLALE 385
            |....:.::.:|        .|||...|..:.......:....:.|...||     ||.:::.|.
Zfish   323 PLCWLYQIVKLLYSFGIYITYALQFYVSAEILIPPAVARCGPRWALMVDLS-----IRVALVGLT 382

  Fly   386 VLVAEFVPSFDALMDVVGGTITGPLVFILPPLL 418
            ..:|..:|..|.::.:||...:..|..|:||||
Zfish   383 CALAILIPELDLVISLVGSVSSSALALIIPPLL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 70/349 (20%)
slc36a1XP_021336836.1 SLC5-6-like_sbd 44..453 CDD:320982 82/401 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.