DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and CG8785

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_610804.1 Gene:CG8785 / 36391 FlyBaseID:FBgn0033760 Length:474 Species:Drosophila melanogaster


Alignment Length:351 Identity:71/351 - (20%)
Similarity:150/351 - (42%) Gaps:55/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 FGILLVLSIIILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAAL--AELA-----YGP------ 147
            ||:.:.|.:       .||.:.|  :..|:..|....|:...:||  ||.|     |||      
  Fly    95 FGMAMTLIV-------GFLCTHC--VHILVKTSHDICRDAKVSALGFAETAEKVFEYGPKGMRPY 150

  Fly   148 --YMSLLVSVLLDLSIFAMAVPSVVMAAQNLEGVVLRMSAGQYNFSYCYW--AIIVGLVICPLMW 208
              :....|.:.|..:.:|.|...:|..|.:...|:      .|:.. ..|  .|.:.|.:.|.:.
  Fly   151 SNFAKQFVDIGLMATYYAAACVYIVFIATSFHDVI------NYDLK-INWDVRIYIALTVIPCLL 208

  Fly   209 LGSPKHMRGL---AIIAVCVMIVIVALLWFCLFAAPAI--GTPFEGISLELPGFLTVLNSYSILA 268
            :|..:.::.|   :::|...::|..|:..:.:|..|.:  ..|....:..:|.|      ::.:.
  Fly   209 IGQIRDLKWLVPFSMMANIFIVVTFAITLYYMFDEPLVYSDKPLIAKAAHIPLF------FATVI 267

  Fly   269 FQFDIHPVLLTLQIDMKQKSQ-VSWAALIGIAITCSVAIFGSIIAAY---KFGSMIADNLLQSLP 329
            |..:...|::.::..|::... :....::.||:...|::: :||..:   :||..:..::..:||
  Fly   268 FAMEGIGVVMPVENSMRKPQHFLGCPGVLNIAMVTVVSLY-AIIGFFGYVRFGDQVRGSITLNLP 331

  Fly   330 TSVPF-YVMLILMALQLCFS----VTVASSAMFMQIENYFKLPESLSFKRMLIRSSVLALEVLVA 389
            ..... ....:|||:.:.|:    ..|.:..::.:|.:.|. ||..:..::|:||.::.|...||
  Fly   332 EGAWLGDTAKLLMAVAILFTFGLQFYVPNEILWRKISHKFS-PEKHNITQILLRSGIILLSGGVA 395

  Fly   390 EFVPSFDALMDVVGGTITGPLVFILP 415
            ..:|:.:..:.:||......|...:|
  Fly   396 AAIPNLEPFISLVGAVFFSLLGIFVP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 68/337 (20%)
CG8785NP_610804.1 SdaC 60..457 CDD:223884 71/351 (20%)
SLC5-6-like_sbd 62..463 CDD:294310 71/351 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.