DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and CG4991

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001259638.1 Gene:CG4991 / 32695 FlyBaseID:FBgn0030817 Length:496 Species:Drosophila melanogaster


Alignment Length:363 Identity:75/363 - (20%)
Similarity:144/363 - (39%) Gaps:64/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GYFGILLVLSII-ILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAELAYGP--------YM 149
            |..|..::|.|| ::.::...:|.:...:|....|.: ...:||........:||        .|
  Fly   113 GLAGATILLPIIAVMCVHCERMLIRGSVLAVERTPGV-DFLDYPETVEKCFEHGPRPLRKMSRVM 176

  Fly   150 SLLVSVLLDLSIFAMAVPSVVMAAQNL------EGVVLRMSAGQYNFSYCYWAIIVGLVICPLMW 208
            .|:|.:.|.::.|.......|...:||      .|:|:.||            :::.:.:.|.| 
  Fly   177 KLIVEMFLCVTQFGFCAIYFVFITENLHQVLQQNGIVISMS------------MVMLITLLPAM- 228

  Fly   209 LGSPKHMRGLAIIAVCVMIVIVALLWFCLFAA----------PAIGTP--FEGISLELPGFLTVL 261
              .|..|..|..|:...:...|||| |.|.|.          |::|..  |.|.:.....|.|.|
  Fly   229 --IPSLMTNLKYISPVSLFANVALL-FGLIATLTIAFSDGPMPSVGDRHLFTGGAQLALFFGTAL 290

  Fly   262 NSYSILAFQFDIHPVLLTLQIDMKQKSQVSWAALIGIA-----ITCSVAIFGSIIAAYKFGSMIA 321
            .||..:|       ::|.|:..|::..:.|  ...|:.     .|.::.||...::..::|..:|
  Fly   291 FSYEGIA-------LILPLRNSMRRPEKFS--TRFGVLNSTMFFTTALFIFTGFVSYVRWGEEVA 346

  Fly   322 DNLLQSLPTSVPF-YVMLILMALQLCFSVTVASSAMFMQIENYFKLPESLSFK-----RMLIRSS 380
            .::..:|.....| .|:.::.||.:.....:....|...:....|...:.:.|     ::.:|..
  Fly   347 GSITLNLVVEEVFSQVVKVIAALGVFLGYPIQFFVMIKILWPPLKRSNNCTQKYPITSQVCLRFF 411

  Fly   381 VLALEVLVAEFVPSFDALMDVVGGTITGPLVFILPPLL 418
            ::.:...||..||..:..:.::|...:..|.|::|.|:
  Fly   412 MVMMTFGVALVVPKLNLFISLIGALCSTCLAFVIPVLI 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 70/346 (20%)
CG4991NP_001259638.1 SLC5-6-like_sbd 82..489 CDD:294310 75/363 (21%)
SdaC 84..488 CDD:223884 75/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.