DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and SLC36A1

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_011535882.1 Gene:SLC36A1 / 206358 HGNCID:18761 Length:482 Species:Homo sapiens


Alignment Length:359 Identity:67/359 - (18%)
Similarity:136/359 - (37%) Gaps:71/359 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 NLEGVVL--RMSAGQYNFSYCYWAIIVGLVICPLMWLGSPKHMRGLAIIAVCVMI-VIVALLWFC 236
            |.|.|:|  .|.:..|..|:..:.:::..:          :::|.|:|.::...| ::|:|:...
Human   188 NNETVILTPTMDSRLYMLSFLPFLVLLVFI----------RNLRALSIFSLLANITMLVSLVMIY 242

  Fly   237 LFAAPAIGTPFEGISLELPGFLTVLNSYSILAFQFDIHPVLLTLQIDMKQKSQVSWAALIGIAIT 301
            .|....|..| ..:.|..| :.|....:....|.|:...::|.|:..||...:......:|:.|.
Human   243 QFIVQRIPDP-SHLPLVAP-WKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIV 305

  Fly   302 CSVAIFGSIIAAYKFGSMIADNLLQSLPTSVPFYVMLILMALQLCFSVTVASSAMFMQIENYF-- 364
            ..:.|....:...:||:.|..::..:||....:..:.:|.::.:.|:..:........|..:|  
Human   306 TILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVS 370

  Fly   365 KLPESLSF-KRMLIRSSVLALEVLVAEFVPSFDALMDVVGGTITGPLVFILPPLLYRRIRRMERV 428
            :.||.... ..:.:|:.::.|..::|..:|..|.::.:||...:..|..|:||||          
Human   371 RAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLL---------- 425

  Fly   429 HQRIAAEASYGSLPLDLNYDPVDLEMEPLLVISPPTTPRGCWLRFVRLLHRLECDVSCTMAVLIF 493
              .:....|.|..||.:..|.:                                       :.|.
Human   426 --EVTTFYSEGMSPLTIFKDAL---------------------------------------ISIL 449

  Fly   494 GLLATFLSTYLNIFSLASLFTNNSPCLSNLTKHF 527
            |.:...:.||..::.|  :..:|:|...|.|..|
Human   450 GFVGFVVGTYEALYEL--IQPSNAPIFINSTCAF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 52/256 (20%)
SLC36A1XP_011535882.1 SLC5-6-like_sbd 53..459 CDD:294310 59/333 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.