DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and SLC32A1

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_542119.1 Gene:SLC32A1 / 140679 HGNCID:11018 Length:525 Species:Homo sapiens


Alignment Length:373 Identity:87/373 - (23%)
Similarity:157/373 - (42%) Gaps:52/373 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GIFPFVTLPALLVKLGYFGILLVLSIIILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAEL 143
            |:| .:.||..::..||.|:.|::...::..||..:|..| ...|..|..:.:.|: .|.|:|..
Human   131 GMF-VLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIAC-LYEENEDGEVVRVRD-SYVAIANA 192

  Fly   144 AYGPYMSLL------VSVLLDLSIFAMAVPSVVMAAQNLEGVVLRMSAGQYN------FSYCYWA 196
            ...|....|      |:.:::|   .|.....|:.:.||          .||      .|...|:
Human   193 CCAPRFPTLGGRVVNVAQIIEL---VMTCILYVVVSGNL----------MYNSFPGLPVSQKSWS 244

  Fly   197 IIVGLVICPLMWLGSPKHMRGLAIIAVCVMIVI-VALLWFCLFAAPAIGTPFEGISLELPGFLTV 260
            ||...|:.|..:|.:.|.:...:::......|| :.::.:||  :.|....:|.:..    ::.|
Human   245 IIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCL--SRARDWAWEKVKF----YIDV 303

  Fly   261 LN---SYSILAFQFDIHPVLLTLQIDMKQKSQ----VSWAALIGIAITCSVAIFGSIIAAYKFGS 318
            ..   |..|:.|.:.....|.:|:.:|:|.|:    ::|..:....:....|:...:..|.:...
Human   304 KKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYLTWADETKE 368

  Fly   319 MIADNLLQSLPTSVP-FYVMLILMALQLCF--SVTVASSAMFMQIENYFKLPESLSFKRML---- 376
            :|.|||..|:...|. |.|...|::..|.|  :|.|...::|.:....| .|...|....|    
Human   369 VITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAF-FPACYSGDGRLKSWG 432

  Fly   377 --IRSSVLALEVLVAEFVPSFDALMDVVGGTITGPLVFILPPLLYRRI 422
              :|.:::...:|:|.:||.|..||.:.|......|.|:||.|.:.|:
Human   433 LTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 79/342 (23%)
SLC32A1NP_542119.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..107
Aa_trans 115..512 CDD:279788 87/373 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158531
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570025at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100570
Panther 1 1.100 - - O PTHR48017
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.