DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mah and slc38a11

DIOPT Version :9

Sequence 1:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_017952819.1 Gene:slc38a11 / 100487061 XenbaseID:XB-GENE-6045807 Length:391 Species:Xenopus tropicalis


Alignment Length:369 Identity:69/369 - (18%)
Similarity:141/369 - (38%) Gaps:83/369 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GILLVLSIIILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAELAYGPYMSLLVSVLLDLSI 161
            |:||::.:..:..|:..||.:..:|:          ....|.:|....:|.....|:|||..|..
 Frog     9 GLLLLIGVAYVTDYSMILLIKGGSMS----------GTNTYQSLVSKTFGFPGYFLLSVLQFLYP 63

  Fly   162 FAMAVPSVVMAAQNLEGVVLRMSAGQYNFSYCYWAIIV----GLVICPLMW------LGSPKHMR 216
            ||..:...::....|..::.|:....::..|....:::    .::..|:..      ||....:.
 Frog    64 FAAMISYNIVTGDILPKIIQRIPGVSHDSWYVDRHVVIVLSTAVITLPIALYRNMEKLGKVSLLS 128

  Fly   217 GLAIIAVCVMIVIVALLWFCLFAAPAIGTPFEGISLELP--------GFLTVLNSYSILAFQFDI 273
            .|....|.|:|::.|                ..::.|:|        .....:.:..:::|.|..
 Frog   129 LLLTFTVLVIIIVRA----------------TSLTSEIPHTEDAWDFARSNAMQAVGVMSFVFMC 177

  Fly   274 HPVLLTLQIDMKQKSQVSW------AALIGIAITCSVAIFGSI-IAAYKFGSMIADNLLQ-SLPT 330
            |.....:...:::.:..:|      :.|:.:.|:...::||.: ...:..|.:..:...: :|.|
 Frog   178 HHACFLIYGSLEKATVGNWSRITHVSMLLSLFISLQYSVFGYVSFTGFTQGDLFENYCREDNLAT 242

  Fly   331 SVPF-YVMLILMALQL-CFSVTVASSAMFMQIENYF---KLPESLSFKRMLIRSSVLALEVLVAE 390
            ...| |.:.|::...: ||   ||...    |.|.|   .||..|.          ||:.|.:..
 Frog   243 IGRFCYAITIILTYPMECF---VAREV----ISNVFFGGNLPYPLH----------LAVTVAIVS 290

  Fly   391 FVPSFDALMDVVG------GTITG-PLVFILPPLLYRRIRRMER 427
            ...:...:.|.:|      |.::. |||||:||..|  :::.|:
 Frog   291 LTTAVSLVYDCLGMFLELNGVLSATPLVFIIPPACY--LKQSEK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 65/353 (18%)
slc38a11XP_017952819.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.