DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmnat and nmnat1-rbp7a

DIOPT Version :9

Sequence 1:NP_651315.2 Gene:Nmnat / 42987 FlyBaseID:FBgn0039254 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001017629.1 Gene:nmnat1-rbp7a / 108004541 -ID:- Length:251 Species:Danio rerio


Alignment Length:114 Identity:54/114 - (47%)
Similarity:74/114 - (64%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RIAFIACGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASALDRCAMVKL 109
            ::..:|||.|:|.|.|||||||:|:||.|..|.::||.|||||..|.|.||||..|..|..|.:|
Zfish     8 KLVLLACGSFNPITNMHLRMFELARDHLEDTGRYKVVKGIISPVGDGYKKKGLIEACHRLEMARL 72

  Fly   110 ATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSGGGGGDDGE 158
            ||:||.||.:.|||..|.:|:.|..|::||...:::..:|.|...|.|:
Zfish    73 ATESSEWITVDDWESQQPEWVETAKVVRHHHAVLSSENSSNGDNVDTGK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmnatNP_651315.2 NMNAT_Eukarya 46..282 CDD:185681 54/113 (48%)
nmnat1-rbp7aNP_001017629.1 nt_trans 9..>126 CDD:294020 54/113 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.