DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and EPM2A

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_005661.1 Gene:EPM2A / 7957 HGNCID:3413 Length:331 Species:Homo sapiens


Alignment Length:152 Identity:29/152 - (19%)
Similarity:55/152 - (36%) Gaps:37/152 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 TKIFEHVYLGS---EWNASNLEELQKNGVRHILNVTREID--------NFF-----PGTFEYFNV 434
            ::|..:::|||   :.....::...:.|:..::|...|.|        |.:     |.|.    :
Human   158 SRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTM----I 218

  Fly   435 RVYDDEKTNLLKYWDDTFRYITRAKAE---------------GSKVLVHCKMGVSRSASVVIAYA 484
            ::|.:|  .|...|..|....|..:.:               |..|.|||..||.||.:.|..:.
Human   219 KLYREE--GLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWL 281

  Fly   485 MKAYQWEFQQALEHVKKRRSCI 506
            .....|..::....:..:|..:
Human   282 QYVMGWNLRKVQYFLMAKRPAV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 29/152 (19%)
EPM2ANP_005661.1 CBM20_laforin 1..129 CDD:99881
Substrate binding. /evidence=ECO:0000269|PubMed:25544560, ECO:0007744|PDB:4RKK 103..107
PTPc 158..304 CDD:304379 29/152 (19%)
Glucan phosphatase signature motif CXAGXGR. /evidence=ECO:0000305|PubMed:25544560, ECO:0000305|PubMed:26231210 266..272 3/5 (60%)
Substrate binding. /evidence=ECO:0000269|PubMed:25544560, ECO:0007744|PDB:4RKK 267..272 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.