DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp19a

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001121737.1 Gene:dusp19a / 792815 ZFINID:ZDB-GENE-081104-382 Length:213 Species:Danio rerio


Alignment Length:159 Identity:52/159 - (32%)
Similarity:74/159 - (46%) Gaps:21/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 DMDLGEYKSFIDAEMLVILGQMDAPTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFF 425
            |:.:|..|.::      :||..||               |.:...|:|..|.|||||...::|.|
Zfish    62 DLQVGYVKPYL------LLGSQDA---------------AHDFATLRKYKVTHILNVAYGVENAF 105

  Fly   426 PGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQW 490
            |..|.|..:.:.|...|:::.:..:..::|.:||.|...|||||..|||||.||||.|.|.....
Zfish   106 PDLFIYKTLSILDQPDTDIISHIKECAQFIDQAKNEKGVVLVHCNSGVSRSVSVVIGYLMLKENQ 170

  Fly   491 EFQQALEHVKKRRSCIKPNKNFLNQLETY 519
            .|......||..|....||..|:.||:.:
Zfish   171 GFGDTFALVKSARPASCPNPGFMEQLKNF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 3/17 (18%)
DSPc 385..519 CDD:238073 45/133 (34%)
dusp19aNP_001121737.1 DSPc 64..199 CDD:238073 51/155 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.