DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp18

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_776106.1 Gene:Dusp18 / 75219 MGIID:1922469 Length:188 Species:Mus musculus


Alignment Length:165 Identity:47/165 - (28%)
Similarity:75/165 - (45%) Gaps:10/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 TKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDD 450
            ::|.:.:::.:...|:|...|..|.:..::||:.|:.|.|....:|..|.|.|.....|..::|.
Mouse    21 SQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYEDIQYVQVPVVDAPVARLSNFFDS 85

  Fly   451 TFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQ 515
            ....|...:.:..:.|:||..||||||::.:||.||.:......|....|..|..|:||..|..|
Mouse    86 VADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPNSGFWEQ 150

  Fly   516 LETYSGMLDAMKNKEKLQRS---------KSETNL 541
            |..|...|.. ||..::..|         :.||.|
Mouse   151 LIHYELQLFG-KNTMQMMDSPMGRIPDIYEKETRL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 39/132 (30%)
Dusp18NP_776106.1 PTP_DSP_cys 19..176 CDD:391942 44/155 (28%)
Sufficient for mitochondrial localization 95..141 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.