DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp16

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_569714.2 Gene:Dusp16 / 70686 MGIID:1917936 Length:660 Species:Mus musculus


Alignment Length:511 Identity:132/511 - (25%)
Similarity:198/511 - (38%) Gaps:169/511 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 PTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREI--DNFFPGTFEYFNVRVYDDEKTNLLKY 447
            ||:|..::|||.:.:..|.:.:|:||:.::||.:...  .:|.|.: .:..|.|.|.....:|.:
Mouse   159 PTRILPNLYLGCQRDVLNKDLMQQNGIGYVLNASNTCPKPDFIPES-HFLRVPVNDSFCEKILPW 222

  Fly   448 WDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNF 512
            .|.:..:|.:|||....||:||..|:||||::.|||.||.......:|...||::|..|.||.||
Mouse   223 LDKSVDFIEKAKASNGCVLIHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNF 287

  Fly   513 LNQLETY-------SGMLDAMKNKEKLQRS---------------KSETNL-----KSTKDA--- 547
            :.||..|       :|| ...|:|.||...               ||..:|     .||.:|   
Mouse   288 MGQLMDYEKTINNQTGM-SGPKSKLKLLHLDKPSEPVPAASEGGWKSALSLSPPCANSTSEASGQ 351

  Fly   548 RLL-PGSEP---------TPLIQALNQAKSKSTGEAGVTPDGEE-EDGSRMHRR-SIAQKSQRRM 600
            ||: |.|.|         :||:|||          :|:....|: ||.:::.|. |:..||....
Mouse   352 RLVHPASVPSLQPSLLEDSPLVQAL----------SGLQLSSEKLEDSTKLKRSFSLDIKSVSYS 406

  Fly   601 VRRSSS---------------------TSPKTQTAVVTKQQSQSMENLTPERSVAEEPKNMRFP- 643
            ...::|                     |:...|.:.|.:...||.|. :|::..|..||..:.| 
Mouse   407 ASMAASLHGFSSEEALDYYKPSATLDGTNKLCQFSPVQEVSEQSPET-SPDKEEAHIPKQPQPPR 470

  Fly   644 --------------GSNG-----------------ENYSV-------TQNQVLHIQKHTPLSVRT 670
                          ||:|                 :||..       |..|  |:.|...|.::.
Mouse   471 PSESQVTRLHSVRTGSSGSTQRPFFSPLHRSGSVEDNYHTNFLFGLSTSQQ--HLTKSAGLGLKG 533

  Fly   671 RIHDLEAHRADQLPQQ--PVWTSLTKLITQTSHL---------GKSVSGSSSGNIDSRRDSSCSD 724
            ...|:.|      ||.  |..||.....|:.|||         ..|.|..|.|.:     .:|||
Mouse   534 WHSDILA------PQSSAPSLTSSWYFATEPSHLYSASAIYGGNSSYSAYSCGQL-----PTCSD 587

  Fly   725 VFSSQVDSVFAKDEGEKRQRRK-------THSWTESLGPSGGIVLDPTPQQQKQQS 773
                |:.||        |:|:|       ..||.|.         .|..:|.|::|
Mouse   588 ----QIYSV--------RRRQKPTDRADSRRSWHEE---------SPFEKQFKRRS 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 48/135 (36%)
Dusp16NP_569714.2 DSP_MapKP 10..136 CDD:238723
PTP_DSP_cys 157..301 CDD:421693 49/142 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.