DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp28

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_780327.1 Gene:Dusp28 / 67446 MGIID:1914696 Length:163 Species:Mus musculus


Alignment Length:152 Identity:49/152 - (32%)
Similarity:72/152 - (47%) Gaps:6/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 LGQMDAPTKIFEHV----YLGSEWNASNLEELQKNGVRHILNVTREIDN-FFPGTFEYFNVRVYD 438
            :|..:|....|..|    ::|:...|...|.|.:.|:...:||:|:... ..||..| ..|.|:|
Mouse     1 MGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAE-LRVPVFD 64

  Fly   439 DEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRR 503
            |...:||.:.:.|...:..|..:|...||:||.|.||||:|..||.|:.......:|.:.||..|
Mouse    65 DPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDRAFQMVKSAR 129

  Fly   504 SCIKPNKNFLNQLETYSGMLDA 525
            ...:||..|..||:.|...|.|
Mouse   130 PVAEPNLGFWAQLQKYEQTLQA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 49/152 (32%)
DSPc 385..519 CDD:238073 44/138 (32%)
Dusp28NP_780327.1 DSPc 13..146 CDD:238073 43/133 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.