DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp29

DIOPT Version :10

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001034926.2 Gene:dusp29 / 664697 ZFINID:ZDB-GENE-060312-23 Length:189 Species:Danio rerio


Alignment Length:154 Identity:48/154 - (31%)
Similarity:77/154 - (50%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KIFEHVYLGSEWNASNLEELQKNGVRHILNVTR-EIDNFFPGT-------FEYFNVRVYDDEKTN 443
            :::..||:|:|..|.:..:||..|:.||||... |.::...|.       ..|:.|...|....|
Zfish    36 EVWPGVYIGNEETARDRYKLQTLGITHILNAAEGEWNSVDTGAEYYKDMQIHYYGVTAEDTPTFN 100

  Fly   444 LLKYWDDTFRYITRAKAE-GSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIK 507
            :.:|:.....||.:..:: .:|:|:||.||.||||::.:|:.|..:.....||:|.:..||. |.
Zfish   101 ISQYFYSAAEYIQQTLSDPHNKLLLHCVMGRSRSATLFLAFLMLQHGMSLLQAVEQLAHRRH-IC 164

  Fly   508 PNKNFLNQLETYSGMLDAMKNKEK 531
            ||..||.||..    ||....:|:
Zfish   165 PNWGFLKQLRE----LDTHLQEER 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 326..379 CDD:462592
DSP_slingshot 385..523 CDD:350363 45/144 (31%)
dusp29NP_001034926.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.