DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp12

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_071584.1 Gene:Dusp12 / 64014 RGDID:68375 Length:339 Species:Rattus norvegicus


Alignment Length:221 Identity:64/221 - (28%)
Similarity:102/221 - (46%) Gaps:29/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 VYLGSEWNASNLEELQKNGVRHILNVTRE----IDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTF 452
            :|||.....:..:.|::.|:..:|.|..|    ....|.|....| |...|..:|:||.:.|...
  Rat    34 LYLGGAAAVAGPDYLREAGITAVLTVDSEPAFPAGAGFEGLQSLF-VPALDKPETDLLSHLDRCV 97

  Fly   453 RYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLE 517
            .:|.:|::||..|||||..|||||.:||.|:.||..|..|::|.|:::..:...|.|:.|..||:
  Rat    98 AFIGQARSEGRAVLVHCHAGVSRSVAVVTAFIMKTEQLTFEKAYENLQTIKPEAKMNEGFEWQLK 162

  Fly   518 TYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQ---AKSKSTGEAGVTPDG 579
            .|..|           ..:..|:....|..||...:|..|.::.|.:   |...:|...|:..| 
  Rat   163 LYEAM-----------GHEVHTSSAVYKQYRLQKVTEKYPELRNLPRELFAVDPTTVSQGLKDD- 215

  Fly   580 EEEDGSRMHRRSIAQKSQRRMVRRSS 605
                  .:::   .:|.:|.:.||||
  Rat   216 ------ILYK---CRKCRRSLFRRSS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 45/130 (35%)
Dusp12NP_071584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
DSPc 26..165 CDD:238073 45/131 (34%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9UNI6 115..120 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.