DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp19

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001016317.1 Gene:dusp19 / 549071 XenbaseID:XB-GENE-941384 Length:215 Species:Xenopus tropicalis


Alignment Length:216 Identity:58/216 - (26%)
Similarity:93/216 - (43%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 EETESVIKMKLK--------------------AIMMSVDLDEVTSKYIRGRLEEI-LDMDLGEYK 368
            ||.:...|.|||                    :::..||..|.......|.:::: .|:.:|..|
 Frog     6 EEIKGFTKNKLKKQCTRVTTLSGKRIIETWKDSVVQVVDDPEQRDGSGCGYVQDLSTDLQVGAVK 70

  Fly   369 SFIDAEMLVILGQMDAPTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFN 433
            .::      :||..|.               |.:|:.|:|..|.|||||...:||.||..|.|..
 Frog    71 PWL------LLGSQDV---------------AQDLDVLKKYKVTHILNVAYGVDNAFPNEFTYKK 114

  Fly   434 VRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEH 498
            :.:.|..:|::..::.:.|.::...|.:...|||||..||||:.::.|.:.|...:..|.:|...
 Frog   115 MSILDLPETDIASFFPECFNFLENVKLQNGVVLVHCNAGVSRAPAIAIGFLMYDEKINFARAFSI 179

  Fly   499 VKKRRSCIKPNKNFLNQLETY 519
            ||..|....||..|:.||..|
 Frog   180 VKNARPAACPNPGFMEQLHKY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 11/71 (15%)
DSPc 385..519 CDD:238073 41/133 (31%)
dusp19NP_001016317.1 DSP_DUSP19 65..201 CDD:350373 47/157 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.