DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp5

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001015856.1 Gene:dusp5 / 548573 XenbaseID:XB-GENE-957572 Length:375 Species:Xenopus tropicalis


Alignment Length:196 Identity:56/196 - (28%)
Similarity:99/196 - (50%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 APTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTRE-IDNFFPGTFEYFNVRVYDDEKTNLLKY 447
            :|.:|...:||||.::||..|.|....:..:|||:|: ..:.....:.|..:.|.|:...::..:
 Frog   170 SPVEILPFLYLGSAYHASRCEFLANLHITALLNVSRKSSSDLCKEQYSYKWIPVEDNHTADISSH 234

  Fly   448 WDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNF 512
            :.:...:|...|..|.:|||||:.|:|||.::.:||.||..::..::|.|::|:|||.|.||.:|
 Frog   235 FQEAIDFIDTIKRAGGRVLVHCEAGISRSPTICMAYLMKTRRFRLEEAFEYIKQRRSLISPNFSF 299

  Fly   513 LNQLETYSGMLDAMK--------NKEKLQRSKSETNLKSTKDAR--LLPGS--EPTPLIQALNQA 565
            :.||..|...:...|        .::.:.....|.|:..:.:..  ..|.|  .|.||...::|.
 Frog   300 MGQLLHYESEIFPSKVLAPVVSCKRDSVSFFSDELNIGKSYEGSCFTFPTSVLSPVPLRSPVHQL 364

  Fly   566 K 566
            |
 Frog   365 K 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 45/134 (34%)
dusp5NP_001015856.1 DSP_MapKP 6..135 CDD:238723
DSP_DUSP5 171..309 CDD:350487 46/137 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.