Sequence 1: | NP_733063.1 | Gene: | ssh / 42986 | FlyBaseID: | FBgn0029157 | Length: | 1193 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001015856.1 | Gene: | dusp5 / 548573 | XenbaseID: | XB-GENE-957572 | Length: | 375 | Species: | Xenopus tropicalis |
Alignment Length: | 196 | Identity: | 56/196 - (28%) |
---|---|---|---|
Similarity: | 99/196 - (50%) | Gaps: | 13/196 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 384 APTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTRE-IDNFFPGTFEYFNVRVYDDEKTNLLKY 447
Fly 448 WDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNF 512
Fly 513 LNQLETYSGMLDAMK--------NKEKLQRSKSETNLKSTKDAR--LLPGS--EPTPLIQALNQA 565
Fly 566 K 566 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssh | NP_733063.1 | SSH-N | 21..313 | CDD:212166 | |
DEK_C | 328..379 | CDD:285919 | |||
DSPc | 385..519 | CDD:238073 | 45/134 (34%) | ||
dusp5 | NP_001015856.1 | DSP_MapKP | 6..135 | CDD:238723 | |
DSP_DUSP5 | 171..309 | CDD:350487 | 46/137 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |