DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp3

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_006247464.1 Gene:Dusp3 / 498003 RGDID:1560049 Length:212 Species:Rattus norvegicus


Alignment Length:140 Identity:46/140 - (32%)
Similarity:75/140 - (53%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KIFEHVYLGSEWNASNLEELQKNGVRHILNV--------TREIDNFFPGT-FEYFNVRVYDDEKT 442
            ::...||:|:...|.::.:|||.|:.|:||.        .....:|:..| ..|..::..|.::.
  Rat    58 EVIPRVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYKDTGITYMGIKANDTQEF 122

  Fly   443 NLLKYWDDTFRYITRAKA-EGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCI 506
            ||..|::....:|.:|.| :..:|||||:.|.|||.::||||.|...:.:.:.||..|::.|. |
  Rat   123 NLSAYFERAADFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMLRQKMDVRSALSTVRQNRE-I 186

  Fly   507 KPNKNFLNQL 516
            .||..||.||
  Rat   187 GPNDGFLAQL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 46/140 (33%)
Dusp3XP_006247464.1 DSPc 55..200 CDD:238073 46/140 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.