DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp22

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_012820032.1 Gene:dusp22 / 496452 XenbaseID:XB-GENE-486791 Length:212 Species:Xenopus tropicalis


Alignment Length:249 Identity:65/249 - (26%)
Similarity:113/249 - (45%) Gaps:49/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFP-----GTFEYFNVRVYDDEKTNLLK 446
            ||...:::|:..:|.::|:|.||.:.|||::.   |:..|     |..:|..:...|....||::
 Frog     7 KILPSLFIGNFKDARDVEQLHKNNITHILSIH---DSARPMLEVSGGMKYLCIPASDSPSQNLIQ 68

  Fly   447 YWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKN 511
            ::.|:..:|...:.:|...||||..|||||.::|:||.|....:.::.||..|:..|:|..||..
 Frog    69 HFKDSIAFIHECRLKGEGCLVHCLAGVSRSVTLVVAYVMTVTDFGWEDALSAVRGARTCANPNMG 133

  Fly   512 FLNQLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQAKSKSTGEAGVT 576
            |..|||.: |..|..:.:..|:.:..|.......||:           |.|::            
 Frog   134 FQKQLEDF-GKHDVYQFRTWLKETYGENPFNDKDDAK-----------QLLDK------------ 174

  Fly   577 PDGEEEDGSRMHRRSIAQKSQRRMVRRSSSTSPKTQTAVVTKQQSQSMENLTPE 630
                       |::..|.:||      |:::|.:..::.:|...|.|..|.|.|
 Frog   175 -----------HKQQEAAESQ------SATSSGRQWSSHLTSLSSMSYSNYTTE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 45/136 (33%)
dusp22XP_012820032.1 DSPc 4..141 CDD:238073 45/136 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.