DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and dusp22a

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001002514.1 Gene:dusp22a / 436787 ZFINID:ZDB-GENE-040718-219 Length:208 Species:Danio rerio


Alignment Length:218 Identity:61/218 - (27%)
Similarity:101/218 - (46%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFP--GTFEYFNVRVYDDEKTNLLKYWD 449
            |:.:.:|||:..:..|.:.|.:||:.|||:|   .:|..|  ....|..:...|....||.:::.
Zfish     7 KVIDGLYLGNIRDPENRDSLSRNGITHILSV---CNNAKPVLEDMTYLCINAADASSQNLSQHFK 68

  Fly   450 DTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLN 514
            ::.|:|...:..|...||||..|||||.:||:||.|....:.:|:.|..||..||.:.||..|..
Zfish    69 ESIRFIHECRLNGGACLVHCLAGVSRSTTVVVAYLMTVTSYGWQECLTAVKAVRSFVGPNYGFQQ 133

  Fly   515 QLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQAKSKSTGEAGVTPDG 579
            ||:.:.     ||     |.|:.:..|:::..:......|....:.:|...:.:         .|
Zfish   134 QLQEFQ-----MK-----QVSEYQAWLRASYRSSPFKDQEQVEALLSLFAEQQQ---------QG 179

  Fly   580 EEED------GSRMHRRSIAQKS 596
            ::.|      |||::..|..|.|
Zfish   180 QQNDPEWMSQGSRIYPLSYNQYS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 46/133 (35%)
dusp22aNP_001002514.1 DSPc 4..139 CDD:238073 46/134 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.