Sequence 1: | NP_733063.1 | Gene: | ssh / 42986 | FlyBaseID: | FBgn0029157 | Length: | 1193 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002514.1 | Gene: | dusp22a / 436787 | ZFINID: | ZDB-GENE-040718-219 | Length: | 208 | Species: | Danio rerio |
Alignment Length: | 218 | Identity: | 61/218 - (27%) |
---|---|---|---|
Similarity: | 101/218 - (46%) | Gaps: | 30/218 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 387 KIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFP--GTFEYFNVRVYDDEKTNLLKYWD 449
Fly 450 DTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLN 514
Fly 515 QLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQAKSKSTGEAGVTPDG 579
Fly 580 EEED------GSRMHRRSIAQKS 596 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssh | NP_733063.1 | SSH-N | 21..313 | CDD:212166 | |
DEK_C | 328..379 | CDD:285919 | |||
DSPc | 385..519 | CDD:238073 | 46/133 (35%) | ||
dusp22a | NP_001002514.1 | DSPc | 4..139 | CDD:238073 | 46/134 (34%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |