DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and CG15528

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster


Alignment Length:121 Identity:40/121 - (33%)
Similarity:59/121 - (48%) Gaps:3/121 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 LQKNGVRHILNVTREI-DNFFPGTFE--YFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLV 467
            :.|.||..::||..|: |...|....  |..:...|..:.:|.|::|:....|......|...|:
  Fly    64 MDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCTLI 128

  Fly   468 HCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGML 523
            ||..|||||||:.:||.||......::|.:||:..|..::||..|..||..|...|
  Fly   129 HCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 38/115 (33%)
CG15528NP_651767.2 DSPc 43..181 CDD:238073 38/116 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462487
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.