DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Mkp3

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:478 Identity:96/478 - (20%)
Similarity:177/478 - (37%) Gaps:140/478 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 AMWSALQTLHK---------VSKKARENNFYASGPSHDWL----SSYERRIESDQSCLNEWNAMD 304
            ||.|.:..||:         |:.:...|||..:.|  :|.    .::.:.|||.::.  :.:.:.
  Fly   111 AMDSIISILHRRLKQDGCRVVALQDGFNNFRQAFP--EWCEDDNQTHSKEIESSRNV--QTDQLM 171

  Fly   305 ALESRR--PPSPDAIRNKPPEKEETESVIKMKLKAIMMSVDLDEVTSKYIRGRLEEILDMDLGEY 367
            .|.|.|  ....|:..:...|..:.||                  :|.:....          .:
  Fly   172 GLRSLRISTTQSDSACSSSAESSDCES------------------SSHHHHHH----------SH 208

  Fly   368 KSFIDAEMLVILGQMDAPTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFF--PGTFE 430
            .::.:|.:.:|.|.:          :||:..::.:.|.|:|..::::||||.::.|.|  .|..:
  Fly   209 HNYNEAPVEIIPGLL----------FLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIK 263

  Fly   431 YFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQA 495
            |..:.:.|....:|..::.|..::|..|::..|.|||||..|||||.:|.:||.|.........|
  Fly   264 YLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDA 328

  Fly   496 LEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQ 560
            ...|:.|:..:.||.:|:.||.::...|                        ||.|||..:....
  Fly   329 FAMVRDRKPDVSPNFHFMQQLLSFESQL------------------------RLRPGSRFSCSCI 369

  Fly   561 ALNQAKSKSTG--------EAGVTPDG---------------EEEDGSRMHRRSIAQKSQRRMVR 602
            |.:....::||        ..||:||.               .|:.|.    :|......:.:..
  Fly   370 APDCNCMQTTGFMATHLANATGVSPDSGIEFDRWTPSDTGLKXEQSGG----KSFVLPPSQEVPF 430

  Fly   603 RSSSTSPKTQTAVVTKQQSQSMENLTPERSVAEEPKNMRFPGSNGENYSVTQNQVLHIQKHTPLS 667
            .:::|||...                   .:|..|.||. |.|...:.:.|          |..:
  Fly   431 AAAATSPLPM-------------------CLAVNPDNMS-PASTTSSSTST----------TTTA 465

  Fly   668 VRTRIHDLEAHRADQLPQQPVWT 690
            ....:.::..||..::.::.:.|
  Fly   466 EAVSVVEMVQHRDQEMAEEDIIT 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166 17/74 (23%)
DEK_C 328..379 CDD:285919 4/50 (8%)
DSPc 385..519 CDD:238073 41/135 (30%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723 10/38 (26%)
DSPc 215..353 CDD:238073 43/147 (29%)
CDC14 <242..359 CDD:225297 38/140 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462485
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.