DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp15

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001102068.2 Gene:Dusp15 / 362238 RGDID:1305990 Length:244 Species:Rattus norvegicus


Alignment Length:231 Identity:61/231 - (26%)
Similarity:99/231 - (42%) Gaps:27/231 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 TKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDD 450
            ||:...:|||:..:|.:.::|.:|.:.||::: .|..........|..:.|.|..:..:.|::.:
  Rat     6 TKVLPGLYLGNFIDAKDPDQLGRNKITHIVSI-HESPQPLLQDITYLRISVSDTPEVPIKKHFKE 69

  Fly   451 TFRYITRAKAEGSKVLVHCK--------MGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIK 507
            ...:|...:..|...||||.        .|:|||.:|||||.|......:|:.||.:|..|....
  Rat    70 CVHFIHSCRLNGGNCLVHCLSFTSGSFFAGISRSTTVVIAYVMTVTGLGWQEVLEAIKASRPIAN 134

  Fly   508 PNKNFLNQLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQAKSKSTGE 572
            ||..|..|||.: |..::.|.:.:|:....|...:..:|.|.|     .||.:...|....|...
  Rat   135 PNPGFRQQLEEF-GWANSQKLRRQLEERFGEIPFRDEEDLRAL-----LPLCRRCRQGPGTSAPS 193

  Fly   573 AGVTPDGEEEDGSRMHRRSIAQKSQRRMVRRSSSTS 608
            | .|......:|           :.:|:|.||...|
  Rat   194 A-TTASSAASEG-----------TLQRLVPRSPRES 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 42/140 (30%)
Dusp15NP_001102068.2 DSPc 4..146 CDD:238073 42/140 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.