DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Styxl1

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001032877.2 Gene:Styxl1 / 360792 RGDID:1305845 Length:321 Species:Rattus norvegicus


Alignment Length:300 Identity:67/300 - (22%)
Similarity:128/300 - (42%) Gaps:55/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 SVKVYEKTHIFKPVSVQAMWSALQTLHKVSKKARENNFYASGPSHDWLSSYERRIESDQSCLNEW 300
            |.:.|:::|:.             |..:|.|:           .|.:|......:|..:.|:...
  Rat    38 SKRQYDESHVI-------------TARRVKKR-----------DHQYLIPESVDLECVKYCIVYD 78

  Fly   301 NAMDALE-SRRPPSPDAIRNKPPEKE--ETESVI----KMKLKAIMMSVDLDEVTSKYI-RGRLE 357
            :...:|| |.||...:....:..|||  |.:|.:    .::...|::......|   || ||..|
  Rat    79 SNTSSLELSIRPRYEEEEEEEEEEKEGKEDDSELLPGPAVEFGQILIHFTRQPV---YILRGGYE 140

  Fly   358 EILDMDLGEYKSFIDAEMLVILGQMDA----PTKIFE-HVYLGSEWNASNLEELQKNGVRHILNV 417
                ...|.|..|...:::.:..::||    |.:|.. .|:||....|.|.:..:...::..:|:
  Rat   141 ----CFSGLY
HFFRTQKVIWMPQELDAFLPYPIEIVPGKVFLGKLSQACNAKMHKDLKIKAHVNI 201

  Fly   418 TREIDNFFPGTFE-YFNVRVYDDEKTNLLKYWDDTFRYIT-----RAKAEGSKVLVHCKMGVSRS 476
            :.|...:|.|..: ..::::.|...:.|.    .:||:|:     ..|.. |.:||....|:|||
  Rat   202 SLETTPYFVGNVDKLLHIKIEDTPDSILF----PSFRHISHFIELHLKLR-SVILVFSTRGISRS 261

  Fly   477 ASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQL 516
            .:.|:|:.|...:...:::..||||.::.::||:..:.||
  Rat   262 VAAVVAFLMHYNEETLKRSWAHVKKCKTNMRPNRALVAQL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166 15/77 (19%)
DEK_C 328..379 CDD:285919 11/55 (20%)
DSPc 385..519 CDD:238073 34/138 (25%)
Styxl1NP_001032877.2 RHOD 33..146 CDD:412175 28/138 (20%)
PTP_DSP_cys 158..311 CDD:421693 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.