DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and DUSP29

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001003892.1 Gene:DUSP29 / 338599 HGNCID:23481 Length:220 Species:Homo sapiens


Alignment Length:282 Identity:71/282 - (25%)
Similarity:108/282 - (38%) Gaps:84/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 TESVIKMKLKAIMMSVDLDEVTSKYIRGRLEEILDMDLGEYKSF-----IDAEMLVILG--QMDA 384
            |...:|..||....|       :|.:..::||     .||.:.:     .:.|.|...|  |...
Human     2 TSGEVKTSLKNAYSS-------AKRLSPKMEE-----EGEEEDYCTPGAFELERLFWKGSPQYTH 54

  Fly   385 PTKIFEHVYLGSEWNASNLEELQKNGVRHILNVT-------------REIDNFFPGTFEYFNVRV 436
            ..:::..:|:|.|..|.:...|||.|..|:||..             |::|      .:|..|..
Human    55 VNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMD------IQYHGVEA 113

  Fly   437 YDDEKTNLLKYWDDTFRYITRAKAEG-SKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVK 500
            .|....:|..::.....:|.||.::. ||:||||.||.||||::|:||.|.........|::.|.
Human   114 DDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVA 178

  Fly   501 KRRSCIKPNKNFLNQLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQA 565
            |.| |:.||:.||.||......|  ::.:.:.||.                              
Human   179 KNR-CVLPNRGFLKQLRELDKQL--VQQRRRSQRQ------------------------------ 210

  Fly   566 KSKSTGEAGVTPDGEEEDGSRM 587
                        |||||||..:
Human   211 ------------DGEEEDGREL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 11/55 (20%)
DSPc 385..519 CDD:238073 47/147 (32%)
DUSP29NP_001003892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 8/38 (21%)
DUPD1 45..201 CDD:350423 50/164 (30%)
Substrate binding. /evidence=ECO:0000305 146..153 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.