DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and MKP-4

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001259717.1 Gene:MKP-4 / 32963 FlyBaseID:FBgn0031044 Length:387 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:123/270 - (45%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 VYLGSEWNASNLEELQKNGVRHILNVTREIDNF-FPG--------TFEYFNVRVYDDEKTNLLKY 447
            ::||:...|:::|.|:...:.|||.    :|:. .|.        |.:|  :::.|..:.::|::
  Fly    46 LFLGNLTAATHMETLRSFKITHILT----LDSVPLPQHILEASFLTTKY--IQIADMPREDILQH 104

  Fly   448 WDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNF 512
            .:....:|:.|.|:...|||||..|||||:|.||||.||.:..:|..|.|.||.:|..::||..|
  Fly   105 LEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYELVKAKRRFVQPNAGF 169

  Fly   513 LNQLETYSGM---LDAMKNKEKLQRSKSETNLKSTKDARLLPGS--------------EPTPLI- 559
            ::||:.:..|   :|....:.|:.|.:...  :..:.|::||.|              .|.|:: 
  Fly   170 VSQLKLFRRMGCKIDPNCQRYKIHRLRLAG--EQMRKAKILPQSFHSVVRPDPDITRENPEPIVF 232

  Fly   560 ------------QALNQAKSKSTGEAGVTPDGEEE-----------DGSRMHR--RSIAQKSQRR 599
                        ..:.:.|.:......|.|..:||           |.:..|.  |.:.|.|:| 
  Fly   233 RCRRCRRVLASKSHVLEHKPRDRPPQEVVPKEKEEVAAAKLPAQSHDQAENHHGARMLEQLSER- 296

  Fly   600 MVRRSSSTSP 609
             :|:||..||
  Fly   297 -IRQSSLGSP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 45/135 (33%)
MKP-4NP_001259717.1 DSPc 39..176 CDD:238073 45/135 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I2226
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.