DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp2

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001012089.1 Gene:Dusp2 / 311406 RGDID:1305804 Length:318 Species:Rattus norvegicus


Alignment Length:257 Identity:67/257 - (26%)
Similarity:119/257 - (46%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 WNAMDALESRRPPS-------PD-AIRNKPPEKEETESVI-----------------KMKLKAIM 339
            |||:....:|..|:       || |:|.:....|...:|:                 .:.|.|:.
  Rat    55 WNALLRRRARGTPAAALACLLPDRALRARLGRGELARAVVLDESSASVAELPPDGPAHLLLAALQ 119

  Fly   340 MSVDLDEVTSKYIRGRLE---------------EILDMDLGEYKSFIDAEMLVILGQMDAPTKIF 389
            ..:....:...::||..|               :.|.....|..|   ::..|.:.....|.:|.
  Rat   120 HEMRAGPMAVCFLRGGFESFQAYCPDLC
SEAPAQALPPAGAENNS---SDPRVPIYDQGGPVEIL 181

  Fly   390 EHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRY 454
            .::||||..::|:|:.||..|:..:|||:....|.|.|.|.|.::.|.|::...:..::.:...:
  Rat   182 PYLYLGSCNHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGF 246

  Fly   455 ITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQL 516
            |...|..|.:|||||:.|:||||::.:||.:::::....:|.:.||:||..|.||.:|:.||
  Rat   247 IDSVKNSGGRVLVHCQAGISRSATICLAYLIQSHRVRLDEAFDFVKQRRGVISPNFSFMGQL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166 4/12 (33%)
DEK_C 328..379 CDD:285919 10/82 (12%)
DSPc 385..519 CDD:238073 47/132 (36%)
Dusp2NP_001012089.1 DSP_MapKP 12..147 CDD:238723 16/91 (18%)
DSPc 176..312 CDD:238073 47/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.