DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp19

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001101209.2 Gene:Dusp19 / 311151 RGDID:1307457 Length:220 Species:Rattus norvegicus


Alignment Length:167 Identity:59/167 - (35%)
Similarity:90/167 - (53%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 GRLEEI-LDMDLGEYKSFIDAEMLVILGQMDAPTKIFEHVYLGSEWNASNLEELQKNGVRHILNV 417
            |.:::: ||:.:|..|.::      :||..||               |.:||.|:::.|.|||||
  Rat    54 GYVQDLTLDLQVGVIKPWL------LLGSQDA---------------AHDLELLRQHKVTHILNV 97

  Fly   418 TREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIA 482
            ...::|.|...|.|..:.:.|..:||:|.|:.:.|.:|.:||.:...|||||..||||:|:|||.
  Rat    98 AYGVENVFLSEFTYKTISILDVPETNILSYFPECFEFIEQAKLKDGVVLVHCNAGVSRAAAVVIG 162

  Fly   483 YAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETY 519
            :.|.:.:..|..||..||:.|..|..|..|:.||.||
  Rat   163 FLMSSEELAFTNALSLVKEARPSICLNPGFMEQLRTY 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 5/25 (20%)
DSPc 385..519 CDD:238073 48/133 (36%)
Dusp19NP_001101209.2 DSPc 64..199 CDD:238073 54/155 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.