DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp26

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001012352.1 Gene:Dusp26 / 306527 RGDID:1310090 Length:211 Species:Rattus norvegicus


Alignment Length:172 Identity:54/172 - (31%)
Similarity:93/172 - (54%) Gaps:10/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 RGRLEEILDMDLGEYKSFIDAEMLVILGQ--MDAPTKIFEHVYLGSEWNASNLEELQKNGVRHIL 415
            ||.|||:..:. ..:.:..:.|.|:..|:  .:...:::..:|||.:..|:|..||::.|:.|:|
  Rat    29 RGSLEEMPSVH-HPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL 92

  Fly   416 NVTREIDNFFPGTFE-----YFNVRVYDDEKTNLLKYWDDTFRYITRAKAE-GSKVLVHCKMGVS 474
            |.:.......|..:|     |..|..:|....::..::.....:|.||.:: |.|:||||.:|||
  Rat    93 NASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSVHFQTAADFIHRALSQPGGKILVHCAVGVS 157

  Fly   475 RSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQL 516
            |||::|:||.|..:.:...:|::.||..|..| ||:.||.||
  Rat   158 RSATLVLAYLMLYHHFTLVEAIKKVKDHRGII-PNRGFLRQL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919 7/25 (28%)
DSPc 385..519 CDD:238073 46/138 (33%)
Dusp26NP_001012352.1 DSPc 61..202 CDD:238073 46/139 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.