DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp13

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_036014538.1 Gene:Dusp13 / 27389 MGIID:1351599 Length:324 Species:Mus musculus


Alignment Length:259 Identity:65/259 - (25%)
Similarity:110/259 - (42%) Gaps:67/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RRIESD-QSCLNEW--------NAMDAL---ESRRPPSPDAIR---NKPPEKEETESVIKMKLKA 337
            ||:||. .||.:|.        :.||:|   |.|||....|::   .:||.....:.::.::..|
Mouse   103 RRLESSGTSCGSEKTTARSGSPHRMDSLQKQELRRPKIHGAVQVSPYQPPTLASLQRLLWVRRTA 167

  Fly   338 IMMSVDLDEVTSKYIRGRLEEILDMDLGEYKSFIDAEMLVILGQMDAPTKIFEHVYLGSEWNASN 402
            .:..::                                           :::.:::||..:.|.:
Mouse   168 TLTHIN-------------------------------------------EVWPNLFLGDAYAARD 189

  Fly   403 LEELQKNGVRHILNVTR---EID---NFFPGT-FEYFNVRVYDDEKTNLLKYWDDTFRYITRA-K 459
            ...|.:.|:.|::||..   ::|   .|:.|| .||:.:...|:...:|..::....|||..| .
Mouse   190 KGRLIQLGITHVVNVAAGKFQVDTGAKFYRGTPLEYYGIEADDNPFFDLSVHFLPVARYIRDALN 254

  Fly   460 AEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGML 523
            ...|:|||||.|||||||::|:|:.|.........|::.|:..|. |.||..||.||:.....|
Mouse   255 IPRSRVLVHCAMGVSRSATIVLAFLMIFENMTLVDAIQTVQAHRD-ICPNSGFLRQLQVLDNRL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166 14/36 (39%)
DEK_C 328..379 CDD:285919 1/50 (2%)
DSPc 385..519 CDD:238073 46/141 (33%)
Dusp13XP_036014538.1 PTP_DSP_cys 154..317 CDD:421693 47/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.