DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and pmp1

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_595205.1 Gene:pmp1 / 2540019 PomBaseID:SPBC1685.01 Length:278 Species:Schizosaccharomyces pombe


Alignment Length:191 Identity:54/191 - (28%)
Similarity:84/191 - (43%) Gaps:45/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 ILNVTREIDNFFPGTFEYFNVRVYDDEKTNL-------LKY----WDDTFRYIT----------- 456
            ::||.:|:.:.|     ..:.|.|.|.|.||       ::|    ||...::..           
pombe    86 VINVAKEVLHPF-----RTDGRHYRDSKHNLDIQVFDHIEYVHIHWDHDTQFALELDKLVSFVAY 145

  Fly   457 RAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSG 521
            .|.....|||::|:||:||||.::||:.||........|.|:||:|...|.||.:.:.||..|..
pombe   146 NAMQLNKKVLINCQMGISRSACLMIAFIMKTLNLNVSDAYEYVKERSPWIGPNMSLIFQLSEYQQ 210

  Fly   522 MLDAMKNKEKLQRSKSETNLKSTK---DARLL----PGSEPTPLIQALNQAKSKSTGEAGV 575
            ::    .|...|.....::||.:|   :..||    |.|...||:       |.||.|:.:
pombe   211 II----RKNSSQGPYQSSSLKQSKRKSEGNLLFPEKPHSAQLPLV-------SPSTSESSM 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 38/126 (30%)
pmp1NP_595205.1 CDC14 35..227 CDD:225297 41/149 (28%)
DSPc 61..209 CDD:238073 38/127 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.