DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp15

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001152848.1 Gene:Dusp15 / 252864 MGIID:1934928 Length:235 Species:Mus musculus


Alignment Length:223 Identity:60/223 - (26%)
Similarity:100/223 - (44%) Gaps:20/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 TKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDD 450
            ||:...:|||:..:|.:.::|.:|.:.||::: .|..........|..:.|.|..:..:.|::.:
Mouse     6 TKVLPGLYLGNFIDAKDPDQLGRNKITHIISI-HESPQPLLQDITYLRISVSDTPEVPIKKHFKE 69

  Fly   451 TFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQ 515
            ...:|...:..|...||||..|:|||.::||||.|......:|:.||.:|..|....||..|..|
Mouse    70 CVHFIHSCRLNGGNCLVHCFAGISRSTTIVIAYVMTVTGLGWQEVLEAIKASRPIANPNPGFRQQ 134

  Fly   516 LETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQAKSKSTGEAGVTPDGE 580
            ||.: |..::.|.:.:|:....|...:..:|.|.|     .||.:...|..:.|...|...    
Mouse   135 LEEF-GWANSQKLRRQLEERFGEIPFRDEEDLRAL-----LPLCRRCRQGSATSAASATTA---- 189

  Fly   581 EEDGSRMHRRSIAQKSQRRMVRRSSSTS 608
                     .|.|:.:.:|:|.||...|
Mouse   190 ---------SSAAEGTLQRLVPRSPRDS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 41/132 (31%)
Dusp15NP_001152848.1 DSPc 4..138 CDD:238073 41/132 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..212 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.