Sequence 1: | NP_733063.1 | Gene: | ssh / 42986 | FlyBaseID: | FBgn0029157 | Length: | 1193 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038670.1 | Gene: | Dusp1 / 19252 | MGIID: | 105120 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 62/195 - (31%) |
---|---|---|---|
Similarity: | 101/195 - (51%) | Gaps: | 15/195 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 385 PTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWD 449
Fly 450 DTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLN 514
Fly 515 QLETYSGMLDAMKNKEK--------LQRSKSETNLKSTKDARLLPGSEPT-PLIQALNQAKSKST 570
Fly 571 570 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ssh | NP_733063.1 | SSH-N | 21..313 | CDD:212166 | |
DEK_C | 328..379 | CDD:285919 | |||
DSPc | 385..519 | CDD:238073 | 47/133 (35%) | ||
Dusp1 | NP_038670.1 | DSP_MapKP | 7..136 | CDD:238723 | |
DSPc | 173..309 | CDD:238073 | 47/134 (35%) | ||
CDC14 | 188..313 | CDD:225297 | 41/124 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2281 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.850 |