DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp1

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_038670.1 Gene:Dusp1 / 19252 MGIID:105120 Length:367 Species:Mus musculus


Alignment Length:195 Identity:62/195 - (31%)
Similarity:101/195 - (51%) Gaps:15/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 PTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWD 449
            |.:|...:||||.::||..:.|...|:..::||:....|.|.|.::|.::.|.|:.|.::..:::
Mouse   174 PVEILSFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFN 238

  Fly   450 DTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLN 514
            :...:|...|..|.:|.|||:.|:||||::.:||.|:..:.:..:|.|.||:|||.|.||.:|:.
Mouse   239 EAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMG 303

  Fly   515 QLETYSGMLDAMKNKEK--------LQRSKSETNLKSTKDARLLPGSEPT-PLIQALNQAKSKST 570
            ||..:...:.|.....:        |.|..|.|.:.:      .|.|.|. |...|||..||..|
Mouse   304 QLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFN------FPVSIPVHPTNSALNYLKSPIT 362

  Fly   571  570
            Mouse   363  362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 47/133 (35%)
Dusp1NP_038670.1 DSP_MapKP 7..136 CDD:238723
DSPc 173..309 CDD:238073 47/134 (35%)
CDC14 188..313 CDD:225297 41/124 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.