DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and DUSP4

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_001385.1 Gene:DUSP4 / 1846 HGNCID:3070 Length:394 Species:Homo sapiens


Alignment Length:365 Identity:87/365 - (23%)
Similarity:152/365 - (41%) Gaps:93/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 ENATAAG--DNKNTSGMEE--SCLLGIDCNERTTIGLVVPILADTTIHLDGDGGFSVKVYEKTHI 245
            ||...||  .:..|.|:..  .||| :||.         |.||.:..::.|    ||.|...|.:
Human    23 ENGGGAGGSGSHGTLGLPSGGKCLL-LDCR---------PFLAHSAGYILG----SVNVRCNTIV 73

  Fly   246 FK----PVSVQAMWSALQTLHKVSKKAR-ENNFYASGPSHDWLSSYERRIESDQSCLNEWNAMDA 305
            .:    .||::.:..|.:.:     :|| .:..|::...:|                        
Human    74 RRRAKGSVSLEQILPAEEEV-----RARLRSGLYSAVIVYD------------------------ 109

  Fly   306 LESRRPPSPDAIRNKPPEKEETESVIKMKLKAIMMSVDLDEVTSKYIRGRLEEILDMDLGEYKSF 370
               .|.|..:::|.        :|.:.:.::|:..:.:..::.  .::|..|..    ..||..|
Human   110 ---ERSPRAESLRE--------DSTVSLVVQALRRNAERTDIC--LLKGGYERF----SSEYPEF 157

  Fly   371 ID----------------AEMLVI--------LGQMDAPTKIFEHVYLGSEWNASNLEELQKNGV 411
            ..                .|.|.:        |.....|.:|...:||||.::|:..:.|...|:
Human   158 C
SKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGI 222

  Fly   412 RHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRS 476
            ..:|||:.:..|.|.|.::|..:.|.|:.|.::..::.:...||...|....:|||||:.|:|||
Human   223 TALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRS 287

  Fly   477 ASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQL 516
            |::.:||.|...:...::|.|.||:|||.|.||.:|:.||
Human   288 ATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166 27/136 (20%)
DEK_C 328..379 CDD:285919 9/74 (12%)
DSPc 385..519 CDD:238073 48/132 (36%)
DUSP4NP_001385.1 DSP_MapKP 9..158 CDD:238723 35/194 (18%)
DSPc 195..331 CDD:238073 48/133 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.