DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and DUSP3

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_004081.1 Gene:DUSP3 / 1845 HGNCID:3069 Length:185 Species:Homo sapiens


Alignment Length:175 Identity:49/175 - (28%)
Similarity:83/175 - (47%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KIFEHVYLGSEWNASNLEELQKNGVRHILNVTREID--------NFFPGT-FEYFNVRVYDDEKT 442
            ::...:|:|:...|.::.:|||.|:.|:||......        ||:..: ..|..::..|.::.
Human    32 EVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEF 96

  Fly   443 NLLKYWDDTFRYITRAKAE-GSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCI 506
            ||..|::....:|.:|.|: ..:|||||:.|.|||.::||||.|...:.:.:.||..|::.|. |
Human    97 NLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNRE-I 160

  Fly   507 KPNKNFLNQLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLP 551
            .||..||.||                    .:.|.:..|:.:|.|
Human   161 GPNDGFLAQL--------------------CQLNDRLAKEGKLKP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 45/141 (32%)
DUSP3NP_004081.1 DUSP3 10..177 CDD:350427 46/165 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.