DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and DUSP2

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:XP_016859035.1 Gene:DUSP2 / 1844 HGNCID:3068 Length:342 Species:Homo sapiens


Alignment Length:326 Identity:77/326 - (23%)
Similarity:135/326 - (41%) Gaps:70/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SALQTLHKVSKKARENNFYASGPSHDWLSSYERRIESDQSCLNEWNAMDALESRRPPS------- 313
            :||.||.:..::|.........|   :|:...|.:.:.:..  .|||:....:|.||:       
Human    12 AALGTLLRDPREAERTLLLDCRP---FLAFCRRHVRAARPV--PWNALLRRRARGPPAAVLACLL 71

  Fly   314 PD-AIRNKPPEKEETESVI-----------------KMKLKAIMMSVDLDEVTSKYIRGR----- 355
            || |:|.:....|...:|:                 .:.|.|::...........::||.     
Human    72 PDRALRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGEQAGRP 136

  Fly   356 ------------LEEILDMDLGEYKSF----------IDAEMLVILG-------------QMDAP 385
                        .:..|.:..|.:..|          ..|..|...|             ....|
Human   137 WPAPPDSSPAFPADRALPLLAGGFDGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGP 201

  Fly   386 TKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDD 450
            .:|..:::|||..::|:|:.||..|:..:|||:....|.|.|.|.|.::.|.|::...:..::.:
Human   202 VEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQE 266

  Fly   451 TFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQ 515
            ...:|...|..|.:|||||:.|:||||::.:||.|::.:....:|.:.||:||..|.||.:|:.|
Human   267 AIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQ 331

  Fly   516 L 516
            |
Human   332 L 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166 13/56 (23%)
DEK_C 328..379 CDD:285919 10/94 (11%)
DSPc 385..519 CDD:238073 47/132 (36%)
DUSP2XP_016859035.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.