DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and F13D11.3

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_508975.2 Gene:F13D11.3 / 180847 WormBaseID:WBGene00017428 Length:174 Species:Caenorhabditis elegans


Alignment Length:166 Identity:43/166 - (25%)
Similarity:74/166 - (44%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 TKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDD 450
            |::..|::|.. :.......|::..:.|.::.|........| .:...|.|.|:....:.:|::.
 Worm    12 TQVRPHLFLAG-YGCITPSLLKQYNITHGVDCTNLKTKPIKG-LDRIEVPVDDNTLAKITQYFEP 74

  Fly   451 TFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQ 515
            ..:||..||.:|...:::|..||||||::.|.|.|.......::|...|.:.|..|.||..|..|
 Worm    75 VVKYIEDAKQQGHNTVIYCAAGVSRSATLTIVYLMVTENLSLEEAYLQVNQVRPIISPNIGFWRQ 139

  Fly   516 LETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLP 551
                  |:|.    ||.:...:...|.|.:.||.:|
 Worm   140 ------MIDF----EKQRNGNASVELISGRMARPVP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 34/132 (26%)
F13D11.3NP_508975.2 DSPc 11..146 CDD:214551 37/145 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.