DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and Dusp5

DIOPT Version :9

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_598262.2 Gene:Dusp5 / 171109 RGDID:620854 Length:384 Species:Rattus norvegicus


Alignment Length:173 Identity:54/173 - (31%)
Similarity:84/173 - (48%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 PTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWD 449
            |.:|...:||||.::||..|.|....:..:|||:|...........|..:.|.|....::..::.
  Rat   179 PVEILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACTTHLHYKWIPVEDSHTADISSHFQ 243

  Fly   450 DTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLN 514
            :...:|...:.||.||||||:.|||||.::.:||.||..|:..::|.|::|:|||.:.||..|:.
  Rat   244 EAIDFIDCVREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFRLKEAFEYIKQRRSVVSPNFGFMG 308

  Fly   515 QLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTP 557
            ||..|                          ::.:|| |.|||
  Rat   309 QLLQY--------------------------ESEILP-STPTP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 328..379 CDD:285919
DSPc 385..519 CDD:238073 47/133 (35%)
Dusp5NP_598262.2 DSP_MapKP 5..140 CDD:238723
Nuclear localization signal. /evidence=ECO:0000255 53..74
DSP_DUSP5 179..316 CDD:350487 48/162 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.