DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssh and DUSP19

DIOPT Version :10

Sequence 1:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster
Sequence 2:NP_543152.1 Gene:DUSP19 / 142679 HGNCID:18894 Length:217 Species:Homo sapiens


Alignment Length:178 Identity:62/178 - (34%)
Similarity:93/178 - (52%) Gaps:24/178 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 DMDLGEYKSFIDAEMLVILGQMDAPTKIFEHVYLGSEWNASNLEELQKNGVRHILNVTREIDNFF 425
            |:.:|..|.::      :||..||               |.:|:.|:||.|.|||||...::|.|
Human    63 DLQVGVIKPWL------LLGSQDA---------------AHDLDTLKKNKVTHILNVAYGVENAF 106

  Fly   426 PGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQW 490
            ...|.|.::.:.|..:||:|.|:.:.|.:|..||.:...|||||..||||:|::||.:.|.:.|.
Human   107 LSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQT 171

  Fly   491 EFQQALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKNK-EKLQRSKS 537
            .|..|...||..|..|.||..|:.||.||....::  || :::|.:.|
Human   172 SFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKES--NKCDRIQENSS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 326..379 CDD:462592 3/17 (18%)
DSP_slingshot 385..523 CDD:350363 51/137 (37%)
DUSP19NP_543152.1 DSP_DUSP19 65..201 CDD:350373 56/156 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.